PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g06270.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 410aa    MW: 42569.3 Da    PI: 9.5905
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g06270.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3980140262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e+alkcprCdstntkfCyynnyslsqPr+fCkaCrryWt GG+lrnvPvGgg+r+nk+ss
  Zjn_sc00002.1.g06270.1.am.mk  80 PERALKCPRCDSTNTKFCYYNNYSLSQPRHFCKACRRYWTSGGSLRNVPVGGGCRRNKRSS 140
                                   68899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3464136IPR003851Zinc finger, Dof-type
PfamPF027015.1E-3382138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.72184138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MVFTYLDPPI WNNQQGQQPR ASGGGDAPLL PVGPAAATGM APEATGLPSS STAAASAAGA  60
AQTRPNSMAE RARVARMPQP ERALKCPRCD STNTKFCYYN NYSLSQPRHF CKACRRYWTS  120
GGSLRNVPVG GGCRRNKRSS KSSSAGASSS SKPSSSARQL PSGPSSTPST PGGVTSGIIP  180
SGLNSLSHQY LPFLGSMQQP GGNLGLAFSA GLPPLGMQHV DTGDQFPVAS GGASLDQWRV  240
QQQHQVQFPF LAGGVLDLQP RPQMYQLGLE ANRVSSGSPA SAFTLGALGQ ANGTPARQEG  300
TMKLDLDDSK GQEMSLQRQY MAALRHGDGI WDGNAGGSGG DGGGNDGATW PMNIPGFRSS  360
STGDGGDHMA SDGGGAARRQ AEACVAPHAI GRPGHQRQRV LDATYQLTIM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984738.11e-130PREDICTED: dof zinc finger protein DOF3.6 isoform X2
SwissprotQ9M2U17e-48DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLK4ABE01e-130K4ABE0_SETIT; Uncharacterized protein
STRINGSi036197m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.13e-40Dof family protein